SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000020932 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000020932
Domain Number 1 Region: 84-171,296-333
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 4.45e-47
Family Inhibitor of apoptosis (IAP) repeat 0.00000532
Further Details:      
 
Domain Number 2 Region: 1-84
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 4.71e-32
Family Inhibitor of apoptosis (IAP) repeat 0.0001
Further Details:      
 
Domain Number 3 Region: 196-290
Classification Level Classification E-value
Superfamily DEATH domain 1.37e-23
Family Caspase recruitment domain, CARD 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000020932   Gene: ENSSSCG00000023589   Transcript: ENSSSCT00000026024
Sequence length 358
Comment pep:known chromosome:Sscrofa10.2:9:36957941:36969067:1 gene:ENSSSCG00000023589 transcript:ENSSSCT00000026024 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNTEKDRLLTFQMWPLTFLSPADLAKAGFYYIGPGDRVACFACGGKLSNWEPKDDAMTEH
LRHFPNCPFLGNQLQDSSRYTVSNLSMQTYAARFKTFCNWPSSIPVHPEQLASAGFYYMG
HSDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEYLIRIKGQEFISRVQASYPHLLEQL
LSTSDNPEDENAEPPNDLSLIRKNRMALFQHLTCVLPILDSLLIARVISEQEHDVIKQKT
QTSLQARELIDIILVKGNYAATIFKNSLQEIDPMLYKHLFVQQDIKYIPTENVSDLSMEE
QLRRLQEERTCKVCMDKEVSIVFIPCGHLVVCKDCAPSLRKCPICRGTIKGTVRTFLS
Download sequence
Identical sequences O62640
ENSSSCP00000020932 ENSSSCP00000020932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]