SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000020935 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000020935
Domain Number 1 Region: 2-153
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000719
Family SMI1/KNR4-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000020935   Gene: ENSSSCG00000026953   Transcript: ENSSSCT00000028255
Sequence length 250
Comment pep:known_by_projection chromosome:Sscrofa10.2:6:113245005:113290173:-1 gene:ENSSSCG00000026953 transcript:ENSSSCT00000028255 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MISSWEQKNNCLLPEDLKNFYLMTNGFHMTWSVKLDEHTIPLGSMAINSISKLTQLNQSS
MYSLPNAPTLADLEDDTQEGNWTGENQPEKPHFDSRSVIFELDPCNGNGKVCLVYKRGKP
ALAQDSEIWFLDRALYWHFLTDTFTAYYRLLITHLGLPQWQYAFTSYGISPQAKQWFNMY
KPITYNTNLLTEETDSFVNKLDPSKVFKSKNKTLIPKKKGPPQPAGGQKGPSGPPSTSKS
SSGSGNPVRK
Download sequence
Identical sequences ENSSSCP00000020935 ENSSSCP00000020935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]