SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000021029 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000021029
Domain Number 1 Region: 173-306
Classification Level Classification E-value
Superfamily BRCT domain 3.93e-21
Family DNA ligase 0.036
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000021029
Domain Number - Region: 117-194
Classification Level Classification E-value
Superfamily BRCT domain 0.00114
Family 53BP1 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000021029   Gene: ENSSSCG00000028605   Transcript: ENSSSCT00000023415
Sequence length 417
Comment pep:novel chromosome:Sscrofa10.2:13:82291027:82365552:1 gene:ENSSSCG00000028605 transcript:ENSSSCT00000023415 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPEEPYIHANYQPVEIPVSNKPESKTALLKRKNSSFSKKDFGPSEKQEQADEDLLSQYV
TNDATVVEAAKSEVGPFNDSTHVEPLNESSHISLQEENQSSVSHCLPDASTVTEEGLFNQ
KSFLILGFSNENESNIATIIRENAGKIVSLQSRIVADYAVVPLLGCEVQATVGEVVTNTW
LVTCIDYQTLIDPKSNPLFTPVPVMAGMTPLEDCVISFSQCAGAEKDSLTFLANRLGASV
QEYFVRKSNAKKGMFASTHLVLKEPGGSKYEAAKKWNLPAVTIAWLLETARMGKRANESC
FLIENPPKEEQSLEAGTTNGVNLNPNTPEHPVKQLETQRKTAITPLDMNRFQSKAFRAVI
SQHSGQASVSPAVGQPLQKEPSLHLDTPSKFLSKDKLFKPSFDVKVRFIENRLGNNI
Download sequence
Identical sequences ENSSSCP00000021029 ENSSSCP00000021029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]