SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000021046 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000021046
Domain Number 1 Region: 94-190
Classification Level Classification E-value
Superfamily Outer arm dynein light chain 1 3.4e-19
Family Outer arm dynein light chain 1 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000021046   Gene: ENSSSCG00000021937   Transcript: ENSSSCT00000026839
Sequence length 194
Comment pep:novel chromosome:Sscrofa10.2:1:186834717:186853118:1 gene:ENSSSCG00000021937 transcript:ENSSSCT00000026839 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIPGKYRSVSGRAASNVNCGLHLVIQTSSLPEKNKVEFRLNKETSSFPGRLLQHDLERNY
SSRQGDHINLVSSSMPSFPILQRSSEEKILYSDRLTLERQKLTVCPIIDGEEHLRLLNFQ
HNFITRIQNISNLQRLIFLDLYDNQIEEISGLSTLRSLRVLLLGKNRIKKISNLENLKSL
DVLDLHGNQVLLNP
Download sequence
Identical sequences ENSSSCP00000021046 ENSSSCP00000021046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]