SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000021147 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000021147
Domain Number 1 Region: 43-133
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 5.04e-37
Family SCAN domain 0.0000753
Further Details:      
 
Domain Number 2 Region: 355-411
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.95e-24
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 3 Region: 581-638
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.74e-23
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 4 Region: 533-582
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.18e-19
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 5 Region: 767-819
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.93e-17
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 6 Region: 400-452
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.71e-16
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 7 Region: 627-679
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000446
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 8 Region: 694-747
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000103
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 9 Region: 221-272
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000000034
Family KRAB domain (Kruppel-associated box) 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000021147   Gene: ENSSSCG00000022023   Transcript: ENSSSCT00000030708
Sequence length 830
Comment pep:known_by_projection chromosome:Sscrofa10.2:3:6588959:6611396:-1 gene:ENSSSCG00000022023 transcript:ENSSSCT00000030708 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIMTESGEVIDLDPPAETSQEQEDLLIVKVEEEDCTWMQEYNPPAFETFYQRFKHFQYHE
ASGPREALSQLRVLCCEWLRPELHTKEQILELLVLEQFLTILPEEFQTWVREHHPESGEE
AVAVVESIQRELEERRQQIVACPEGLPQKRVLPGAEPESFSHQLLSVEPQPEQEPQKPHL
LEEQALPALQVPSLPLKDSQELTASLLSAGSQKLVKIEDVADVAVSFILEEWGHLDPSQK
SLCRDDRKENYGSIPSMDYESRNDNVELRVKQVSDEAEAPWMTSGSPGSTAAPSQGFAEV
SELQGVVERWQVSPAGGKSRQNPSQKREPVPDDGNRKPNTSGERGHRCNDCGKFFLQASN
FIQHRRIHTGEKPFKCGECGKSYNQRVHLTQHQRVHTGEKPYKCQVCGKAFRVSSHLVQH
HSVHSRERPYGCPECGKSFGRHSHLIEHLKRHFREKPQRCSDKRSKTTKLNVKKRISEFS
EAEGRIQRSISQGQDFGDGREHQGTLERKQGIPRKELLGQPSSKRMNFSDVAYVHKKSST
GERPHKCNECGKSFIQSAHLIQHQRIHTGEKPFRCDECGKSYNQRVHLTQHQRVHTGEKP
YTCPLCGKAFRVRSHLVQHQSVHSGERPFKCSECGKGFGRRSHLAGHLRLHSREKSHQCH
ECGEIFFQYVSLIEHQVLHMGPKNEQNGIREEAYSWNLTVIEDKKLELQEQPYKCDVCGK
AFRYSSDLIQHYRTHTAEKAAKCDTCRESGGPCSHVKPHPKSCSTLKAHQCTECGRGFTL
KSHLNQHQRIHTGEKPFQCKECGMSFSWSCSLFKHLRSHERTDPINAFSG
Download sequence
Identical sequences ENSSSCP00000021147 ENSSSCP00000021147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]