SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000021307 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000021307
Domain Number 1 Region: 48-71
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000288
Family LDL receptor-like module 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000021307   Gene: ENSSSCG00000021548   Transcript: ENSSSCT00000025825
Sequence length 86
Comment pep:novel chromosome:Sscrofa10.2:9:50319576:50322739:1 gene:ENSSSCG00000021548 transcript:ENSSSCT00000025825 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PKFTWQEGQKLPLIGCILLLIALVVSLIVLFYFWRGHTKIKYKEPVESCPKNAVHCDGVV
DCKLRSDELGCGKEAGRVCVCLYVRV
Download sequence
Identical sequences ENSSSCP00000021307 ENSSSCP00000021307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]