SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000021675 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000021675
Domain Number 1 Region: 16-338
Classification Level Classification E-value
Superfamily Phosphofructokinase 1.44e-96
Family Phosphofructokinase 0.000000604
Further Details:      
 
Domain Number 2 Region: 340-603
Classification Level Classification E-value
Superfamily Phosphofructokinase 4.71e-82
Family Phosphofructokinase 0.0000285
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000021675   Gene: ENSSSCG00000021129   Transcript: ENSSSCT00000029955
Sequence length 607
Comment pep:known_by_projection chromosome:Sscrofa10.2:5:81676291:81694184:1 gene:ENSSSCG00000021129 transcript:ENSSSCT00000029955 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTHEEHHAAKSLGVGKAIAVLTSGGDAQVFQGSVKAVLRTNIHGGLRIWHCHEGYQGLVD
GGDNIREATWESVSMMLQLGGTVIGSARCKDFREREGRLRAAHNLVKRGITNLCVIGGDG
SLTGADTFRSEWGDLLNDLQKAGKITAEEANKSSYLNIVGLVGSIDNDFCGTDMTIGTDS
ALHRIIEIVDAITTTAQSHQRTLCLEVMGRHCGYLALVTSLSCGADWVFIPECPPDDAWE
EHLCRRLSETRTRGSRLNIIIVAEGAIDKNGQPITSENIKDLVVKRLGYDTRVTVLGHVQ
RGGTPSAFDRILGSRMGVEAVMALLEGTPDTPACVVSLSGNQAVRLPLMECVQVTKDVTK
AMNEKRFDEAMKLRGRSFMNNWEVYKLLAHVRPPVTKSGSYTVAVMNVGAPAAGMNAAVR
STVRIGLIQGNRVLVVHDGFEGLAKGQIEEAGWSYVGGWTGQGGSKLGTKRTLPKKSFEQ
ISANITKFNIQGLVIIGGFEAYTGGLELMEGRKQYDELCIPFVVIPATVSNNVPGSDFSV
GADTALNTICMTCDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAAGADAAYIFEEPF
TIRDLQV
Download sequence
Identical sequences ENSSSCP00000021675 ENSSSCP00000021675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]