SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000021730 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000021730
Domain Number 1 Region: 437-461
Classification Level Classification E-value
Superfamily Notch domain 0.0000693
Family Notch domain 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000021730
Domain Number - Region: 967-1039
Classification Level Classification E-value
Superfamily EF-hand 0.00437
Family Parvalbumin 0.091
Further Details:      
 
Domain Number - Region: 500-527
Classification Level Classification E-value
Superfamily Notch domain 0.00968
Family Notch domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000021730   Gene: ENSSSCG00000000862   Transcript: ENSSSCT00000028915
Sequence length 1249
Comment pep:known chromosome:Sscrofa10.2:5:86352832:86413187:1 gene:ENSSSCG00000000862 transcript:ENSSSCT00000028915 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPLKLLQRQTYTCLSHRYGLYVCFVGVVVTIVSAFQFGEVVLEWSRDQYHVLFDSYRDNI
AGKSFQNRGFSLPHKIDLRVKAIFSSILLPFLRVRGELLESWQQDSVRLAVWKNSANTKC
KSSPFKKCILLTAVIKVSEIRAPPSGQHSILPPYRFYHLRLVMQNIQELRMSHNNLYFVL
FYKFKDTQISQGTGLLKFYWHKQFLTTDYIIVLKVHRLTFTWYSNYTSRFKIFILTKFSE
YNLRSRINLLQLYSEASVALLKLNNPKDFQELNKQTKKNMTVDGKELTISPAYLLWDLSA
ISQSKQDEDVSASRFEDNEELRYSLRSIERHAPWVRNIFIVTNGQIPSWLNLDNPRVTIV
THQDVFRNLSHLPTFSSPAIESHIHRIEGLSQKFIYLNDDVMFGKDVWPDDFYSHSKGQK
VYLTWPVPNCAEGCPGSWIKDGYCDKACNNSACDWDGGDCSGNSGGSRYIPGGGGTGSMG
GGQPWHFGGGITGVSYCNQGCANSWLADKFCDQACNVLSCGFDAGDCGQDHFHELYKVTL
LPNQTHYVIPKGECLPYFSFAEIAKRGIEGAYSDNPIIRHASIANKWKTIHLILHSGMNA
TTIHFNLTLQSTNGEEFKIQLAVEVDTREEPKRNSTTQKSYQDLVSPTVLLPEVEIPFED
IPEEKRFPKVKRHDANTTGKFQVEVEVPLVNISLLPKEAQLSLSNLDLQLELGDITLKGY
NLSKSALLRPFLMNPRYAELAVNQAPVTGQRNDSMEAPLGKQVHRSIYPSSLGTPERSQG
SLPLPAVTMRVNGHSQSQTPLDLETKARLRSQTLTQTMGGRSVSKEKFSSLIVSLEKKET
QEKIITGKEQEKNRLGENANSHLGGDEVLPGRKLQYYTDSYLGFLPWEKKKYFQDLLDEE
ESLKTQLAYFTDSKHTGRHLKDTFADSLRYVNKILNSKFGFTSRKVPAHMPHMIDRIVMQ
ELQDMFPEEFDKTSFHKVRHSEDMQFAFSYFYYLMSAVQPLNVSQVFDEVDTDQSGVLSD
REIRTLATRIHDLPLSLQDLTGLEHMLINCSKMLPANITQLNNIPPTQEAYYDPNLPPVT
KSLVTNCKPVTDKIHKAYKDKNKYRFEIMGEEEIAFKMIRTNVSHVVGQLDDIRKNPRKF
VCLNDNIDHNHKDAQTVKAVLRDFYESMFPIPSQFELPREYRNRFLHMHELQEWRAYRDR
LKFWTHCVLATLIMFTIVSFFAEQLIALKRKIFPRRRIHKEASPDRIRV
Download sequence
Identical sequences ENSSSCP00000021730 ENSSSCP00000000921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]