SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000021756 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000021756
Domain Number 1 Region: 312-373
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000754
Family LIM domain 0.00089
Further Details:      
 
Domain Number 2 Region: 370-440
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000186
Family LIM domain 0.0015
Further Details:      
 
Domain Number 3 Region: 284-310
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000452
Family LIM domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000021756   Gene: ENSSSCG00000027486   Transcript: ENSSSCT00000028933
Sequence length 481
Comment pep:known_by_projection chromosome:Sscrofa10.2:3:8140290:8143649:1 gene:ENSSSCG00000027486 transcript:ENSSSCT00000028933 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGPTWLPPKQPEPARAPQGRALPRGASGPPPAHGAALQSHPRVNFCPLPSEQCYQAPGG
PEDPGLAWVGCHGAPQRSQGLPPDRGALRPGSLDAEIDSLTSMLAELDGGRGHAPRRPDR
QAYEPHQLPAYRSGPGSLKPNGGSVPPTPLPAASYGGPTPASYATASTPAGPAFPVQVKV
AQPVRGCGPPRRGAPQASGPLPGPHFPLPGRGEVWGAGYRSHREPGPGGKEEAAGVSGPP
GGRGGGYGPQVPLSQPPEEELERLTKKLVQDMNHPPSGEYFGRCGGCGEDVVGDGAGVVA
LDRVFHVGCFVCSTCRAHLRGQHFYAVERRAYCESCYVATLEKCSTCSQPILDRILRAMG
KAYHPGCFTCVVCHRGLDGIPFTVDATSQIHCIEDFHRKFAPRCSVCGGAIMPEPGQEET
VRIVALDRSFHVGCYKCEECGLLLSSEGECQGCYPLDGHILCKACSAWRIQELSATVTTD
C
Download sequence
Identical sequences I3LCI1
ENSSSCP00000021756 XP_003354526.1.46622 ENSSSCP00000021756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]