SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000021938 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000021938
Domain Number 1 Region: 169-245
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000996
Family Motor proteins 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000021938   Gene: ENSSSCG00000021140   Transcript: ENSSSCT00000028509
Sequence length 248
Comment pep:novel scaffold:Sscrofa10.2:JH118898.1:78467:83253:-1 gene:ENSSSCG00000021140 transcript:ENSSSCT00000028509 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMDEGYDEFHNPLAYSSEDYVRRREQHLHKQKQKRISAQRRQINEDNERWETNRMLTSGV
VHRLEVDEDFEEDSAAKVHLMVHNLVPPFLDGRIVFTKQPEPVIPVKDATSDLAIIARKG
SQTVRKHREQKERKKAQHKHWELAGTKLGDIMGVKKEEEPDKALTEDGKVDYRTEQKFAD
HMKKKSEASSEFAKKKSILEQRQYLPIFAVQQELLTIIRDNSIVIVVGETGSGKTTQLTQ
YLHEDGYT
Download sequence
Identical sequences ENSSSCP00000021938 ENSSSCP00000021938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]