SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000022025 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000022025
Domain Number 1 Region: 334-452
Classification Level Classification E-value
Superfamily BRCT domain 3.93e-25
Family BRCT domain 0.084
Further Details:      
 
Domain Number 2 Region: 188-264
Classification Level Classification E-value
Superfamily BRCT domain 1.57e-17
Family DNA ligase 0.014
Further Details:      
 
Domain Number 3 Region: 93-190
Classification Level Classification E-value
Superfamily BRCT domain 0.00000000000000615
Family DNA-repair protein XRCC1 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000022025   Gene: ENSSSCG00000025221   Transcript: ENSSSCT00000025847
Sequence length 585
Comment pep:novel chromosome:Sscrofa10.2:18:3230275:3250517:1 gene:ENSSSCG00000025221 transcript:ENSSSCT00000025847 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHRPPQQPQPLPQQLQPLPQQQALQQQLHQLQQQQLAQFQQQQLARLHQQQQTQTQAPQA
LQHQPPPPQPPPPQHQHQLFGHDPAVEIPEEGFLLGCVFAIVDYPEQMSDKQLLATWKRI
IQAHGGAVDPTFSSRCTHLLCESQVSGLFAQAIKERKRCVTAHWLNAVLKKKRLVPPHRA
LHFPVAFPPGGKPCSQHIISVTGFVDSDRDDLKLMAYLAGAKYTGYLCRSNTVLICKEPT
GLKYEKAKEWRIPCVNAQWLGDILLGNFEALRQIQCGRYTAFNLQDPFAPTPHLVLNLLD
AWRVPLKVSAELLMGVRLPPKPKQNEVTNIQPSSKRARIEDVPPPTKKLTPELTPFVLFT
GFEPLQVQQYTKKLYILGGEVAESAQKCTHLIASKVTRTVKFLTAISVVKHIVTPEWLEE
CFKCQKFIDEQNYLLRDAEAEVLFSFSLEESLRRAHLAPLFKAKYFYITPGICPSLSTMK
AIVECAGGKVLSKQPSFRKLMEHKQNKSLSEIILISCENDLHLCREYFARGIDVHNAEFV
LTGVLTQTLDYESYPFRSRSAAQTLPLHSPERARPGLCTRGRCCG
Download sequence
Identical sequences ENSSSCP00000022025 ENSSSCP00000022025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]