SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000022049 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000022049
Domain Number 1 Region: 84-132
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000458
Family TSP-1 type 1 repeat 0.004
Further Details:      
 
Domain Number 2 Region: 11-79
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000112
Family TSP-1 type 1 repeat 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000022049   Gene: ENSSSCG00000030037   Transcript: ENSSSCT00000022321
Sequence length 134
Comment pep:known chromosome:Sscrofa10.2:13:50463749:50470300:1 gene:ENSSSCG00000030037 transcript:ENSSSCT00000022321 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTRPADRESCSLQPCEYVWITGEWSECSVTCGKGYRQRLVSCSEIYTGKENYEYSYQTT
INCPGTQPPSVQPCYLRECPVSASWRVGNWGSCSVSCGVGVMHRSVQCLTNEDQPSHLCP
ADLKPEERKTCQNI
Download sequence
Identical sequences ENSSSCP00000022049 ENSSSCP00000022049

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]