SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000022104 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000022104
Domain Number 1 Region: 801-1014
Classification Level Classification E-value
Superfamily ADP-ribosylation 1.87e-78
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.00000000294
Further Details:      
 
Domain Number 2 Region: 666-802
Classification Level Classification E-value
Superfamily Domain of poly(ADP-ribose) polymerase 3.27e-48
Family Domain of poly(ADP-ribose) polymerase 0.000000186
Further Details:      
 
Domain Number 3 Region: 524-647
Classification Level Classification E-value
Superfamily WGR domain-like 2.22e-41
Family WGR domain 0.000000223
Further Details:      
 
Domain Number 4 Region: 111-215
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.91e-31
Family PARP-type zinc finger 0.0065
Further Details:      
 
Domain Number 5 Region: 7-103
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.55e-30
Family PARP-type zinc finger 0.0068
Further Details:      
 
Domain Number 6 Region: 385-465
Classification Level Classification E-value
Superfamily BRCT domain 0.000000000318
Family DNA ligase 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000022104   Gene: ENSSSCG00000023660   Transcript: ENSSSCT00000028077
Sequence length 1018
Comment pep:known_by_projection chromosome:Sscrofa10.2:10:16598158:16636256:-1 gene:ENSSSCG00000023660 transcript:ENSSSCT00000028077 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAESSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKV
GHAIRHPDIEVDGFSELRWDDQQKVKKTAEAGGVTGKGQDGVGSKAEKTLGDFAAEYAKS
NRSTCKGCMEKIEKGHVRLSKKMLDPEKPQLGMIDRWYHPNCFVQNREELGFRPEYSASQ
LKGFSLLTAEDKEALKKQLPGIKSEGKRKGDEVDGVDGVAKKKSKKEKDKESKLEKALKA
QNDLIWNIKDELKKVCSTNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEECSG
QLVFKSDAYYCTGDVTAWTKCMVKTQTPNRKEWVTPKEFREITYLKKLKIKKQDRIFPPE
ASTPVATAPPPPAASAPTAVNSSAPPDKPLSNMKILTLGKLSRNKDEVKAAIEKLGGKLT
GTASKASLCVSTKKEVDKMSKKMEEVKEANVRVVSEDFLQDVSASTKSLQELLCTHILSP
WGAEMKAEVKAEPVEAVAPRGKSGGALPKKSKGPIREEGANKSEKRMKLTLKGGAAVDPD
SGLEHSAHVLEKGGKVFSATLGLVDIVKGTNSYYKLQLLEDDKESRYWIFRSWGRVGTVI
GSNKLEQMPSKEDAIDHFMKLYEEKTGNAWHSKNFTKYPKKFYPLEIDYGQDEEAVKKLT
VNPGTKSKLPKSVQELIKMIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAYAILSEV
QQAVSQGSSDSQILDLSNRFYTLIPHDFGMKKPPLLNNADSVQAKVEMLDNLLDIEVAYS
LLRGGSDDSSKDPIDVNYEKLKTDIKVVDRDSEEAETIRKYVKNTHATTHNAYDLEVIDI
FKIEREGESQRYKPFKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIY
FADMVSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTP
DPAASITMDGVEVPLGTGIPSGVNDTCLLYNEYIVYDIAQVNLKYLLKLKFNFKTSLW
Download sequence
Identical sequences ENSSSCP00000022104 ENSSSCP00000022104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]