SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000022290 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000022290
Domain Number 1 Region: 564-656
Classification Level Classification E-value
Superfamily DEATH domain 2.99e-23
Family DEATH domain, DD 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000022290   Gene: ENSSSCG00000025653   Transcript: ENSSSCT00000029403
Sequence length 662
Comment pep:known_by_projection scaffold:Sscrofa10.2:GL896447.1:16922:64466:1 gene:ENSSSCG00000025653 transcript:ENSSSCT00000029403 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRGGGHTPPLFSLPEARTRFTKSTRDALNNKNIKPLLNTFSQLPGSENEKKCTLDQAFRG
VLEEEIINHSSCENVLAIISLAIGGVTEGICTASTPFVLLGDVLDCLPLDQCDTIFTFVE
KNVATWKSNTFYSAGKNYLLRMCNDLLRRLSKSQNTVFCGRIQLFLARLFPLSEKSGLNL
QSQFNLENVTVFNTNEQESTLGQKHTEDREEGMDVEEGEMGDDEAPTTCSIPIDYNLYRK
FWSLQDYFRNPVQCYEKISWKTFLKYSEEVLAVFKSYKLDDTQASRKKMEELKTGGEHVY
FAKFLTSEKLMDLQLSDSNFRRHILLQYLILFQYLKGQVKFKSSNYVLTDEQSLWIEDTT
KSVYQLLSENPPDGERFSKMVEHILNTEENWNSWKNEGCPSFVKERTSDTKPTRVVRKRT
APEDFLGKGPNKKILMGNEELTRLWNLCPDNMEACKSETRPREYMPTLEEFFEEAIEQAD
PENMVENEYKAVNNSNYGWRALRLLARRSPHFFQPTNQQFKSLPEYLENMVIKLAKELPP
PSEEIKTGEDEDEEDNDALLKENESPDVRRDKPVTGDQIEVFANKLGEQWKILAPYLEMK
DSEIRQIECDSEDMKMRAKQLLVAWQDQEGVHATPENLISALNKSGLSDLAESLTNDNET
NS
Download sequence
Identical sequences ENSSSCP00000022290 ENSSSCP00000022290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]