SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000022296 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000022296
Domain Number 1 Region: 76-218
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 4.84e-23
Family Toll/Interleukin receptor TIR domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000022296   Gene: ENSSSCG00000022413   Transcript: ENSSSCT00000028018
Sequence length 221
Comment pep:known_by_projection chromosome:Sscrofa10.2:9:59051622:59056203:1 gene:ENSSSCG00000022413 transcript:ENSSSCT00000028018 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSTSFPDPRSKKPLGKMADWFRQALSKKPTTTHVSPENRPSDISQSSSQDSPPPLGPS
SEVSPTLPPTHMGADSSSSGRWSKDYDVCVCHSEEDLAVAQELVSYLEGSTSSLRCFLQL
RDATPGGAIVSELCQALSNSHCRVLLITPGFLQDPWCRYQMLQALSEAPGAEGRTIPLMS
GLSRAAYPAELRFMYFVDGRGPDGGFHQVKEAVLRYLRALS
Download sequence
Identical sequences A0A0B8RVF4 A0A287A8A9
ENSSSCP00000022296 XP_003130108.1.46622 XP_005667550.1.46622 XP_020918769.1.46622 XP_020918770.1.46622 XP_020918771.1.46622 XP_020918773.1.46622 9823.ENSSSCP00000016146 9823.ENSSSCP00000016151 ENSSSCP00000022296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]