SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000022364 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000022364
Domain Number 1 Region: 9-295
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000000000011
Family Rhodopsin-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000022364   Gene: ENSSSCG00000021525   Transcript: ENSSSCT00000023151
Sequence length 296
Comment pep:known_by_projection scaffold:Sscrofa10.2:GL892960.2:41686:42576:1 gene:ENSSSCG00000021525 transcript:ENSSSCT00000023151 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRILFFSSVIISAILTFVGLIVNLFIAVVNCKTWVKSHRISSSDRILFSLSITRFFILG
LNTLLFIIPNTARSVYFSTLFLTCWMFLDSNSLWFVTLLNALYCVKIANCQHSMFLLLKR
NLSPKMPRLLLVCVLISAVTTLLYVVLRQVAPLPESVSGRNGTVFDINEGILSLLTPLVL
SSLLQFILNVTAASLVINSLRRHVQRMHRNATVLWNPQTEAHLGAMKLMIYFLILYIPYS
VVTLLHYLPSSVAVDLGAKSIYIIISTFYPPGHSVLILLTHPKLKTKAKKILCCNK
Download sequence
Identical sequences I3LE78
XP_020934252.1.46622 ENSSSCP00000022364 ENSSSCP00000022364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]