SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000022387 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000022387
Domain Number 1 Region: 248-308
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.5e-19
Family Erythroid transcription factor GATA-1 0.00012
Further Details:      
 
Domain Number 2 Region: 200-246
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000109
Family Erythroid transcription factor GATA-1 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000022387   Gene: ENSSSCG00000027237   Transcript: ENSSSCT00000023255
Sequence length 412
Comment pep:known chromosome:Sscrofa10.2:X:47745337:47752876:1 gene:ENSSSCG00000027237 transcript:ENSSSCT00000023255 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFPGLGALGTSEPLPQFMDPALVSSPPESGVFFSSGPEGLDTAVSTAPGTATAAAAALA
YYRDAEAYRHSPVFQVYPLLNCMEGIPGGSPYAGWAYGKPGLYPASTVCPIREDSPPQAA
EDLDGKGGSSFLETLKTERLSPDLLTLGPALTSSIPVPSSAYGGPDFSSTFFSPTGSPLN
PAAYSSPKLRGTLPLTPCEARECVNCGATATPLWRRDRTGHYLCNACGLYHKMNGQNRPL
IRPKKRLIVSKRAGTQCTNCQTTTTTLWRRNASGDPVCNACGLYYKLHQVNRPLTMRKDG
IQTRNRKASGKGKKKRGSSLGGTGAAEGPAGGFMVVAGGSSSGNCGEAASGLTLGPPGTA
HLYQGLGPVVLSGPVSHLMPFPGPLLGSPTGSFTTGPVPPTTTTTVVAPLSS
Download sequence
Identical sequences I3LEA0
ENSSSCP00000022387 NP_001265696.1.46622 ENSSSCP00000022387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]