SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000022447 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000022447
Domain Number 1 Region: 111-223
Classification Level Classification E-value
Superfamily C-type lectin-like 4.2e-31
Family C-type lectin domain 0.0000242
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000022447   Gene: ENSSSCG00000022042   Transcript: ENSSSCT00000023267
Sequence length 224
Comment pep:known chromosome:Sscrofa10.2:2:13320727:13324337:-1 gene:ENSSSCG00000022042 transcript:ENSSSCT00000023267 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGLLLLPLLLLGTVSALHLENDAPHQGRGETQADLRQDLEGSGDQERELALNDEVPESE
GEARAPSSQDAFVDEEAMESDQAALDENVECPREEDRVLMQASTGGQTCSYVLVKRRRTF
KKAQYVCRRCYRGNLISIHNYRTNRFIQRWTSSRNQARFWIGGFIRHWNRCRRFQWSDGS
CWNFQYWAPGHPRNGRGRCVSMTSRGGHWRRTSCKRRLPFVCSI
Download sequence
Identical sequences I3LV61
XP_020938701.1.46622 XP_020938702.1.46622 ENSSSCP00000022447 ENSSSCP00000022447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]