SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000022695 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000022695
Domain Number 1 Region: 524-555,637-683
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000131
Family Anti-sigma factor antagonist SpoIIaa 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000022695   Gene: ENSSSCG00000021813   Transcript: ENSSSCT00000031097
Sequence length 686
Comment pep:known chromosome:Sscrofa10.2:9:118190326:118322545:1 gene:ENSSSCG00000021813 transcript:ENSSSCT00000031097 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIEAIGNQYVVARPVYSANAFGEEHKKKQRRHKTFLDHLKQCCSCSTQKAKRIALSSFPI
ASWLPAYRIKEWLLSDIVSGISTGMVAVLQGLAFALLVTVPPGYGLYAAFFPVIIYFFLG
TSRHISVGPFPVLSMMVGAVVVRLTPTADTADPTVSNSSVGNDSALDDHKVMVAATVTIL
SGIIQMLLGVLKLGFVVIYLSESLISGFTTAAAVHVLVSQLKFMLQLTVPAHTDPFSLFK
VLISVFSQIEKTNIADLVTSLVILFVVFVVKEINQRYKAKLPVPIPIELIMTVIATGVSY
GFDFKNRFKVAVIGEMKSGFQAPITPDAQTLQDTIGDCFGIAVVGFAVAFSVASVYSLKY
DYPIDGNQELIALGVSNICGGLFRGFAASTALSRSGVQESTGGKTQIAGLISAIIVLIVI
LAIGFLLEPLQKSVLAALALGNLKGMLMQFTEIRRLWRKDKYDCIIWIMTFIFAVVLGLG
LGLAASVAFQLLTIVFRTQFPKCSMLANVGRSNIYKNRKDYSDIYEPEGVKIFRCPSPLY
FANIGFFKRKLIDAVGFSPLRILRKRNKALKKIRKLQKKGLLQVTPKGFICTVDCVKDSD
EELDNDKIEELDQPINTTDLPFQIDWNADLPVNIVVPKISLHSLILDFSAVSFLDVSSMR
GLKTILQEFIRIQVDVYIVGTDGKLF
Download sequence
Identical sequences ENSSSCP00000022695 ENSSSCP00000022695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]