SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000022696 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000022696
Domain Number 1 Region: 89-310
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 3.85e-34
Family PhyH-like 0.079
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000022696
Domain Number - Region: 12-56
Classification Level Classification E-value
Superfamily Retrovirus capsid protein, N-terminal core domain 0.0247
Family Retrovirus capsid protein, N-terminal core domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000022696   Gene: ENSSSCG00000021751   Transcript: ENSSSCT00000027827
Sequence length 508
Comment pep:novel chromosome:Sscrofa10.2:9:31018601:31020168:-1 gene:ENSSSCG00000021751 transcript:ENSSSCT00000027827 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ITAMTSRPCGVQNPGCAIMTFYPTLEEFEDFSQYIAYMESQGAHHAGLAKVIPPKGWKAR
QTYEDISDIVIAAPLQQVAFGEAGVFTQYHRKKRAMTVSQYHHLAHTVKYQAPPHLDFED
LEQTYWKTRLYGSPIYGADVSGSLFDENTKQWNLGRLGTIQDLLEQECGVAIDGVNSPYL
YFGMWKTGFAWHTEDMDLYSLNFLHFGEPKTWYAVPPAHGRRLERLARELFPGPARGCEA
FLRHKVALISPTVLKAQGIPFGRVTQEAGEFMVTFPYGYHSGFNHGFNCAEAINFATPRW
VDYGKVASQCSCGEARVVFSMDAFVRILQPERYELWKRGQDRVALEHTEHLSSPGSLELS
AWREVREPGGAAFRPRYCPPRVASRHRRPGSAGGGTCRRAPVRSVSSSPARVRPSSSAAQ
LEASAARSSRKPRSTRWPTPCPATPDLRLSGRHVSNRPPREQGTQEHSWGLKPQPLPAVG
PLMDSPVPLSPGLQHPAEASGHCCAPVP
Download sequence
Identical sequences ENSSSCP00000022696 ENSSSCP00000022696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]