SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000022709 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000022709
Domain Number 1 Region: 45-129
Classification Level Classification E-value
Superfamily Snake toxin-like 0.0000000000000305
Family Snake venom toxins 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000022709   Gene: ENSSSCG00000023627   Transcript: ENSSSCT00000031521
Sequence length 171
Comment pep:known_by_projection chromosome:Sscrofa10.2:15:2011780:2128138:-1 gene:ENSSSCG00000023627 transcript:ENSSSCT00000031521 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAGPALAWLLLLSLLADCLKAAQSRDFTVKDIIYLHPSTTPYPGGFKCFTCEKAADNYE
CNRWAPDIYCPRETRYCYTQHTMEVTGNSISVTKRCVPLEDCLSTGCRDSEHEGHKVCTS
CCEGNICNLPLPRNETEATFATTSPINQTNGHPHCMSVIVSCLWVWLGLTL
Download sequence
Identical sequences I3LF69
ENSSSCP00000022709 ENSSSCP00000022709 XP_003133307.1.46622 XP_020930621.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]