SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000022780 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSSCP00000022780
Domain Number - Region: 99-141
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0855
Family Ribosomal protein S14 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000022780   Gene: ENSSSCG00000030022   Transcript: ENSSSCT00000023992
Sequence length 187
Comment pep:known_by_projection scaffold:Sscrofa10.2:GL896279.1:1084:3118:1 gene:ENSSSCG00000030022 transcript:ENSSSCT00000023992 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EELAKVKTLEGIAAAVGGALGLRAPQEDISRQKEGEKPSGGLPFFHWICQPYFRPGPQEG
SKENGGARSKRALEEEGSTEALSKNKQKKQLRNPHKTFDPSLKPKYAKCDQCGNPKGNRC
VFNLCRGCCKKRDFLHLASLPGHGLLFKTKLEKSLAWKGAQLRPQEPPQAGPAPLGGLPE
AVGSALT
Download sequence
Identical sequences ENSSSCP00000022780 ENSSSCP00000022780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]