SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000022806 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000022806
Domain Number 1 Region: 24-104
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000224
Family DEATH effector domain, DED 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000022806   Gene: ENSSSCG00000030182   Transcript: ENSSSCT00000030680
Sequence length 327
Comment pep:known_by_projection chromosome:Sscrofa10.2:6:45629733:45646518:1 gene:ENSSSCG00000030182 transcript:ENSSSCT00000030680 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALSGSTPAPSWEEDECLDYYGMLSLHRMFEVVGGQLTECELELLAFLLDEVPGAAGGLA
RARSGLELLLELERRGQCDESNLRLLGQLLRVLARHDLLPHLARKRRRPVSPERYSYGTS
SSSSERTESSCRRRRQSSRSSNAQQDQWETGSPPAKRQRRSRGRPNGGARRRRRGGPAAP
QQQQEPARPTSEGKVTCDIRLRVRAEYCEHGPALEQGVASRRPQALARQLDVFGQATAVL
RSRDLGSVVCDIKFSELSYLDAFWGDYLSGALLQALRGVFLTEALREAVGREAVRLLVSV
DEADYEAGRRRLLLMEEEGGRHLPEAS
Download sequence
Identical sequences ENSSSCP00000022806 ENSSSCP00000022806

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]