SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000022819 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000022819
Domain Number 1 Region: 449-506
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4e-25
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 2 Region: 506-562
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.27e-23
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 3 Region: 290-349
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.4e-22
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 4 Region: 551-603
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.7e-21
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 5 Region: 68-133
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.79e-21
Family SCAN domain 0.00029
Further Details:      
 
Domain Number 6 Region: 386-438
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.15e-20
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 7 Region: 252-304
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.51e-19
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 8 Region: 360-397
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000526
Family Classic zinc finger, C2H2 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000022819   Gene: ENSSSCG00000029353   Transcript: ENSSSCT00000022882
Sequence length 609
Comment pep:known_by_projection scaffold:Sscrofa10.2:GL895957.1:99051:118027:-1 gene:ENSSSCG00000029353 transcript:ENSSSCT00000022882 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMASEVPRVTNPLSPLVQVPQEEDEQEEEVATMILEDDSWVQEAVLQEDGPDSEPFAQSA
GKGSPHEEGAGGPQGALGRLRELCRRWLRPEVHTKEQMLTMLPKEIQAWLQEHRPESSEE
AVALVEDLTQTLRDSVSQCLHINYSVLSILPYSKKILWQTKQLHFKDFEIQSENGENSNQ
DIFEDVESHVVFSELPDGGGIPQADWESDLERHCGSRGARGRAPRGARGEVPPQGREAGQ
LIGLQGTYLGEKPYECPQCGKTFSRKSHLITHERTHTGEKYYKCDECGKSFSDGSNFSRH
QTTHTGEKPYKCRDCGKSFSRSANLIIKRHQRTHTGEKPYSCPECGKSFGNRSSLNTHQG
KCKECGESFSYNSNLIRHQRIHTGEKPYKCPDCGQRFSQSSALITHRRTHTGEKPYQCGE
CGKSFSRSSNLATHRRTHLVEKPYKCGKSFSQSSSLIAHQGMHTGEKPYECLTCGESFSW
SSNLIKHQRIHTGEKPYKCSECGKGFSQRSQLVVHQRTHTGEKPYKCLMCGKSFSRGSIL
VMHQRAHLGDKPYRCPECGKGFSWNSVLIIHQRIHTGEKPYKCPECGKGFSNSSNFITHQ
RTHMKEKLY
Download sequence
Identical sequences ENSSSCP00000022819 ENSSSCP00000022819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]