SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000022829 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000022829
Domain Number 1 Region: 203-319
Classification Level Classification E-value
Superfamily Retrovirus capsid protein, N-terminal core domain 1.65e-31
Family Retrovirus capsid protein, N-terminal core domain 0.000097
Further Details:      
 
Domain Number 2 Region: 4-98
Classification Level Classification E-value
Superfamily Retroviral matrix proteins 1.06e-23
Family MMLV matrix protein-like 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000022829   Gene: ENSSSCG00000029495   Transcript: ENSSSCT00000022706
Sequence length 500
Comment pep:novel chromosome:Sscrofa10.2:9:2080873:2082453:-1 gene:ENSSSCG00000029495 transcript:ENSSSCT00000022706 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKSASKPTVLECVVKNFKKGFSRDYGIKLSPRKLCTLCTLEWPSFGVGWPPEGILDMFP
VAAVYNVIAGDPGHPDQFLYIDQWLEIAYLRPPWVRFFPTDQGQCRVLVAQSKKKTLSQK
KVPHIFQGEPDDSPPMPPPYVLPAPPLGAECPQMPDSPLPSVSPPPSASEVPKAMSPPQP
DSPEPMSRRLWSAQGAATPALQMPLRYQPLSTADLLNWKHHTPSYSEKPQVLIDLLEFIF
QTHCPTWIDCWQLLFTLFDTEERWRIVAEAANAGPRADLANWVREAFPEENPQRDYDIEE
GKRNLERYWQVFLQGAKAGTKRPTNRAKISEILQELNESPAKLYERLCESFRIYTPFDPE
APENQQMINAAFVGQAQSDIRKKLQKLEGFAGEEATKLLEIANKVFINRDQVARRDARTR
MKQKVTLLAAALSKPVPPVGPPHRGQGTRPGTRHKARGQGTRPLEHDQCAYCKEKDIGKM
NAPTILRKRPRPHLAGTNLN
Download sequence
Identical sequences ENSSSCP00000022829 ENSSSCP00000022829

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]