SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000022843 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000022843
Domain Number 1 Region: 33-208
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 4.45e-58
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.0000000167
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000022843   Gene: ENSSSCG00000027478   Transcript: ENSSSCT00000026577
Sequence length 220
Comment pep:known_by_projection chromosome:Sscrofa10.2:7:63214718:63238501:-1 gene:ENSSSCG00000027478 transcript:ENSSSCT00000026577 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPSSSKLPGPEVTRPHMESRATCSAAAPLERQFRVLIGVTGSVAALKLPLLVSRLLDIP
GLEVAVVTTERAKHFYNPQDVPVTLYSDADEWEMWKCRSDPVLHIDLRRWADLMLVAPLD
ANTLGKVASGICDNLLTCVIRAWDRSKPLLFCPAMNTAMWEHPLTEQQVCQLKAFGYVEI
PCVAKKLVCGDQGLGAMAEVGTIVDKVKEVLFQHGGFQQS
Download sequence
Identical sequences A0A287BGM1
ENSSSCP00000022843 ENSSSCP00000022843 NP_001230297.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]