SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000022897 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000022897
Domain Number 1 Region: 8-347
Classification Level Classification E-value
Superfamily Phosphofructokinase 1.83e-105
Family Phosphofructokinase 0.000000302
Further Details:      
 
Domain Number 2 Region: 340-749
Classification Level Classification E-value
Superfamily Phosphofructokinase 2.49e-83
Family Phosphofructokinase 0.0000551
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000022897   Gene: ENSSSCG00000028197   Transcript: ENSSSCT00000025356
Sequence length 783
Comment pep:known_by_projection chromosome:Sscrofa10.2:13:217047199:217070998:1 gene:ENSSSCG00000028197 transcript:ENSSSCT00000025356 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATVDLEKLRTSGAGKAIGVLTSGGDAQGMNAAVRAVTRMGIYVGAKVFLICEGYEGLVE
GGENIKPANWLSVSNIIQLGGTVIGSARCKAFTTREGRLAAAYNLVQRGITNLCVIGGDG
SLTGANIFRSEWGSLLAELVSEGRISESTAQTYSHLSIAGLVGSIDNDFCGTDMTIGTDS
ALHRIMEVIDAITTTAQSHQRTFVLEVMGRHCGYLALVSALASGADWLFIPEAPPEDGWE
NFMCERLGETRSRGSRLNIIIIAEGAIDRHGKPITSRYVKDLVVQRLGFDTRVTVLGHVQ
RGGTPSAFDRVLSSKMGMEAVMALLEATPDTPACVVSLSGNQSVRLPLMECVQMTKEVQK
AMDEKRFDEAIQLRGRSFENNWNIYKLLAHQKISKEKTNFSLAILNVGAPAAGMNAAVRS
AVRSGISQGHTVYVVHDGFEGLAKGQVQEVGWHDVAGWLGRGGSMLGTKRTLPKAYLEKI
VENIRTYNIHALLVIGGFEAYEGVLQLVEARGRYEELCIVMCVIPATISNNVPGTDFSLG
SDTAVNAAMEQSCVRARDVEYTYKSKRRVVNICVITAIQVIRDSVDGITRGDRKHLILNG
SFPISRVKANVEHMTEKMKTDIQRGLVLRNEKCHEYYTTEFLYNLYSSEGRGIFDCRTNV
LGHLQQGGAPTPFDRNYGTKLGVKAILWMSEKLRAVYRKGRVFANAPDSACVIGLQKKAV
AFSPVTELKEDTDFEHRMPREQWWLNLRLMLKMLAHYRISMADYVSGELEHVTRRTLSIE
TGF
Download sequence
Identical sequences ENSSSCP00000022897 ENSSSCP00000022897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]