SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000022953 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000022953
Domain Number 1 Region: 32-78
Classification Level Classification E-value
Superfamily Cysteine-rich DNA binding domain, (DM domain) 0.000000000000824
Family Cysteine-rich DNA binding domain, (DM domain) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000022953   Gene: ENSSSCG00000025063   Transcript: ENSSSCT00000032546
Sequence length 234
Comment pep:novel chromosome:Sscrofa10.2:X:66565621:66569173:-1 gene:ENSSSCG00000025063 transcript:ENSSSCT00000032546 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPDEMPTVPCCPLDSTTGLETGAPWGIEFGPRRAIRRCARCHNHGITDQIKDQEHLCLF
QACECHKCVLFSEHCSILPAESALKTMQELHLKRQLTQGLIKSGTTSPKAHSHVKKSSIQ
TGVLSKLPRCSADRSGIGIFVSVLDSSTLEEATNNFTFQEVTQAPCPAQQAPKTSDQDSD
SASLEWQRKLEAAEALLTLRESSQAPSGPTPLLQPSAAPAPAGERGLQPPSRSL
Download sequence
Identical sequences ENSSSCP00000022953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]