SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000023029 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000023029
Domain Number 1 Region: 701-753
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000143
Family Erythroid transcription factor GATA-1 0.0024
Further Details:      
 
Domain Number 2 Region: 1030-1077
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000183
Family Classic zinc finger, C2H2 0.026
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000023029
Domain Number - Region: 492-534
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0586
Family Classic zinc finger, C2H2 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000023029   Gene: ENSSSCG00000027648   Transcript: ENSSSCT00000030987
Sequence length 1095
Comment pep:novel scaffold:Sscrofa10.2:GL893325.2:63796:244245:1 gene:ENSSSCG00000027648 transcript:ENSSSCT00000030987 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRKKNPPLRNIASEGEGQTLEPIGTESKVSGKNKEFSADQMSENTDQSDAAELNNKEEQ
SLHVQDPSSSSKKDLKSSVLSEKAGFNYESPGKGGSLPSYPHDEVTDRNMLAFLSPAAGG
VCEPLKSPQRAEADDPQDMACTPAGDSLETKEDPKMSPKATEETGQAQSGQANCQGSSPV
SVASKNPQVPSDGGVRLNKSKTDLLVNDNPDPAPLSPELQDFKCNICGYGYYGNDPTDLI
KHFRKYHLGLHNRTRQDAELDSKILALHNMVQFSHSKDFQKVNRSVLSGVLQDINSSRPV
LLNGTYDVQVTSGGTFIGIGRKTPDCQGNTKYFRCKFCNFTYMGNSSTELEQHFLQTHPN
KIKTSLPSSEGAKPSEKNSNKSIPALRSSDSGDLGKWQDKITVKAGDDTPVGYSVPIKPL
DSSRQNDVDVLLFHYESAHDAQASDVKQEGNHLQGSDGQQAVKESKEHSCTKCDFITQVE
EEISRHYRRAHSCYKCRQCSFTAAETQSLLEHFNTVHCQEQDITTANGEEDSHAVSTIKE
EPKMDLKVYSLLNPDSKMGEPVSESVVKREKLEDKDGLKEKAWAESSSDDLRSVTWRGAD
ILRGSPSYTQASLGLLTPVSGPQEPTKTLRDSPSVEAIMKVRPVRGLQVSTKGWIQGAKK
KKKKKKSFTSQHPSQNKSKTHSQSSTLSANVVTDGTTNQVQRRRGSGVFCANCLTTKTSL
WRKNANGGYVCNACGLYQKLHSTPRPLNIIKQNNGEQIIRRRTRKRLNPEALQAEQLNKQ
QRGGSEEQVNGSPLERRSEDHLTEGHQREIPLPSLSKYEAQGSLTKSHSAQQPVLVSQTL
DIHKRMQPLHIQIKSPQESTGDPGNSSSVSEGKGSSERGSPIEKYMRPAKHPNYSPPGSP
IEKYQYPLFGLPFVHNDFQSEADWLRFWSKYKLSVPGNPHYLSHVPGLPNPCQNYVPYPT
FNLPPHFSAVGSDNDIPLDLAIKHSRPGPTANGASKEKTKAPSNVKNEGPLNVVKTEKVD
RSTQDELSTKCVHCGIVFLDEVMYALHMSCHGDSGPFQCSICQHLCTDKYDFTTHIQRGL
HRNNAWGENSGKSDR
Download sequence
Identical sequences ENSSSCP00000023029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]