SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000023043 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000023043
Domain Number 1 Region: 3-174
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.55e-75
Family Ephrin receptor ligand binding domain 0.000000991
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000023043   Gene: ENSSSCG00000016231   Transcript: ENSSSCT00000028366
Sequence length 253
Comment pep:novel chromosome:Sscrofa10.2:15:136931236:136936256:1 gene:ENSSSCG00000016231 transcript:ENSSSCT00000028366 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EINHLDSRSVQGELGWIASPLEGGWEEVSIMDEKNTPIRTYQVCNVMEPSQNNWLRTDWI
TREGAQRVYIEIKFTLRDCNSLPGVMGTCKETFNLYYYESDNDKERFIRESQFAKIDTIA
ADESFTQVDIGDRIMKLNTEIRDVGPLSKKGFYLAFQDVGACIALVSVRVFYKKCPLTVR
NLAQFPDTVTGADTSSLVEVRGSCVNNSEEKDVPKMYCGADGEWLVPIGNCLCNAGHEER
NGECQGKESHVVL
Download sequence
Identical sequences ENSSSCP00000023043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]