SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000023188 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000023188
Domain Number 1 Region: 2-268
Classification Level Classification E-value
Superfamily Bet v1-like 7.14e-122
Family Phoshatidylinositol transfer protein, PITP 0.0000000000805
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000023188   Gene: ENSSSCG00000009967   Transcript: ENSSSCT00000024426
Sequence length 273
Comment pep:known_by_projection chromosome:Sscrofa10.2:14:48079114:48143499:-1 gene:ENSSSCG00000009967 transcript:ENSSSCT00000024426 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLIKEFRVVLPCSVQEYQVGQLYSVAEASKNETGGGEGIEVLKNEPYEKDGEKGQYTHK
IYHLKSKVPAFVRMIAPEGSLVFHEKAWNAYPYCRTIVTNEYMKDDFFIKIETWHKPDLG
TLENVHGLDPNTWKTVEIVHIDIADRSQVEPADYKADEDPALFQSVKTKRGPLGPNWKKE
LANNPDCPQMCAYKLVTIKFKWWGLQSKVENFIQKKQEKRIFTNFHRQLFCWIDKWIDLT
MEDIRRMEDETQKELETLRNQGQVRGTSAASDE
Download sequence
Identical sequences ENSSSCP00000010638 ENSSSCP00000023188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]