SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000023194 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000023194
Domain Number 1 Region: 13-233
Classification Level Classification E-value
Superfamily Terpenoid synthases 3.74e-32
Family Isoprenyl diphosphate synthases 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000023194   Gene: ENSSSCG00000023958   Transcript: ENSSSCT00000024393
Sequence length 241
Comment pep:known_by_projection scaffold:Sscrofa10.2:JH118738.1:30449:124605:1 gene:ENSSSCG00000023958 transcript:ENSSSCT00000024393 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RGLVHDSQHNLQLRGLVVLLISKAAGPSSVNASCQNYDMVSGIYSCQRSLAEITELIHTA
LLVHRGIVNLNELQSSDGPLKDMQFGNKIAILSGDFLLANACNGLALLQNTKVVELLASA
LMDLVQGVYHENSTSAKENRITDDIGISTWKEQTFLSHGALLAKSCQAAMELAKHDAEVQ
DMAFQYGKHMAMSHKINSDLQPFIKEKTSDSLTFNLNSAPVVLHQEFLGRDLWIKQIRKV
I
Download sequence
Identical sequences ENSSSCP00000023194 ENSSSCP00000023194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]