SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000023233 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000023233
Domain Number 1 Region: 173-425
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.64e-28
Family G proteins 0.002
Further Details:      
 
Domain Number 2 Region: 501-589
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 8.84e-16
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.0033
Further Details:      
 
Domain Number 3 Region: 411-497
Classification Level Classification E-value
Superfamily Translation proteins 0.0000000000000769
Family Elongation factors 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000023233   Gene: ENSSSCG00000022976   Transcript: ENSSSCT00000025691
Sequence length 603
Comment pep:novel chromosome:Sscrofa10.2:7:44185076:44195847:-1 gene:ENSSSCG00000022976 transcript:ENSSSCT00000025691 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSRVSELFGGCCRPGGGPAVGGTLKARGAGGSSSCGGPKGKKKNGRNRGGKANNPPYLP
PEAEDGNIEYKLKLVNPSQYRFEHLVTQMKWRLQEGRGEAVYQIGVEDNGLLVGLAEEEM
RASLKTLHRMAEKVGADITVLREREVDYDSDTPRKITEVLVRKVPDNQQFLDLRVAVLGN
VDSGKSTLLGVLTQGELDNGRGRARLNLFRHLHEIQSGRTSSISFEILGFNSKGEVVNYS
DSRTAEEICESSSKMITFIDLAGHHKYLHTTIFGLTSYCPDCALLLVSANTGIAAGTTRE
HLGLALALKVPFFIVVSKVDLCAKTTVERTVRQLERVLKQPGCHKVPMLVTSEDDAVTAA
QQFAQSPNVTPIFTLSSVSGESLDLLKVFLNILPPLTNSKEQEELMQQLTEFQVDEIYTV
PEVGTVVGGTLSSGICREGDQLVVGPTDDGCFLELRVCSIQRNRSACRVLRAGQAATLAL
GDFDRALLRKGMVMVSPEMNPTICSVFEAEIVLLFHATTFRRGFQVTVHVGNVRQTAVVE
KIHAKDKLRTGEKAVVRFRFLKHPEYLKVGAKLLFREGVTKGIGHVTDVQAIAAGEAQAN
MAF
Download sequence
Identical sequences 9823.ENSSSCP00000001839 ENSSSCP00000023233 ENSSSCP00000023233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]