SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000023280 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000023280
Domain Number 1 Region: 45-307
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.26e-31
Family FAD-linked reductases, N-terminal domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000023280   Gene: ENSSSCG00000020647   Transcript: ENSSSCT00000031960
Sequence length 378
Comment pep:known_by_projection scaffold:Sscrofa10.2:JH118992.1:207:6130:-1 gene:ENSSSCG00000020647 transcript:ENSSSCT00000031960 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HQCRGLEALSPARPDILVPTGPALGLGAAQRLCCCSALPSLRVXRSERSFGGVVEVGAHW
IHGPSQSNPVYGLLGEKELSEENQLVETGGHVGLPSVTYTSSGGEMSSLFYSLIDQTREF
LHSAEAPAPSVGEYLKKQIREHVASWAEGEKLAILNNLFNVECCVSGTHSMDLVALAPFG
EYTVLPGLDCTFPGGYQGLTDRMAASLPTDVMVFDKPVKTIRWNGSFQEASAPGEAFPVL
VECEDGGCFPAHHVIVTVPLGFLKGHLDTFFEPPLPPEKVEAIRKIGFGTNNKIFLEFEE
PFWEPGCERIQVVWEDLSPLEDVAPELQDAWFKKLIGFWVLPASGYVRISSLSEEALAVP
PARAPALCRFPVGCFWRG
Download sequence
Identical sequences ENSSSCP00000023280 ENSSSCP00000023280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]