SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000023285 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000023285
Domain Number 1 Region: 204-319
Classification Level Classification E-value
Superfamily Retrovirus capsid protein, N-terminal core domain 5.73e-33
Family Retrovirus capsid protein, N-terminal core domain 0.0000723
Further Details:      
 
Domain Number 2 Region: 4-98
Classification Level Classification E-value
Superfamily Retroviral matrix proteins 8.24e-23
Family MMLV matrix protein-like 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000023285   Gene: ENSSSCG00000027759   Transcript: ENSSSCT00000028108
Sequence length 391
Comment pep:novel chromosome:Sscrofa10.2:10:47679563:47680817:-1 gene:ENSSSCG00000027759 transcript:ENSSSCT00000028108 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKSASKPTVLECLVKNFKKGFSRDYGVKLSPGKLCTLCTLEWPSFGVGWPPERTSDVFT
VAAVYNVITGDPGHPDQFRYIYQWLEIAYLKPPWVRFYTKDQGQCRVLVVQSKKKTLSQK
KVPPIFQGEPEDSPPMPPPYVLPAPPLGAEGPQMPDSPLPSVSPPPSASEVPEAISPLPP
DSPEPMSRRLWSAQGAATPALQMPLRDQPFSTADLLNWKHHTPSYSEKPQALIDLLKFIF
QTHCPTWIDCRQLLFTLTEERWQIVTEAQKWLQPNADLANWVRDTFPEENPHWDYDTEEG
KHNLQRYRQALLQGAKAGAKRPTNIAKTSEIPQEPNESPVKFYERLCEAFRIYTAFDSEA
PENQRMINAAFVGQAQSDIRKKLQKLEGRQD
Download sequence
Identical sequences ENSSSCP00000023285 ENSSSCP00000023285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]