SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000023398 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000023398
Domain Number 1 Region: 286-619
Classification Level Classification E-value
Superfamily L domain-like 6.63e-42
Family Ngr ectodomain-like 0.015
Further Details:      
 
Domain Number 2 Region: 685-835
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 8.63e-37
Family Toll/Interleukin receptor TIR domain 0.00023
Further Details:      
 
Domain Number 3 Region: 22-240
Classification Level Classification E-value
Superfamily L domain-like 7.48e-29
Family Ngr ectodomain-like 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000023398   Gene: ENSSSCG00000010885   Transcript: ENSSSCT00000011909
Sequence length 856
Comment pep:known chromosome:Sscrofa10.2:10:21886309:21905776:-1 gene:ENSSSCG00000010885 transcript:ENSSSCT00000011909 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDCLVLLLTLLVASPALGMPSCFFDGQRAIYRGCNLTQVPQVPSGTKSLLLSFNYIRTV
TAGSFPFLEGLQLLELGTQLTPLSIDREAFRNLPNLRILDLGHSQIAFLHPDAFQELPHL
SELRLFSCGLSDAILKDGYFRNLASLTRLDLSKNQIQSLHLHPSFQELNSLKAIDLSLNQ
IPLVCEQGLKPLQGKTLSFLSLADNNLYSRVSVDWGKCMNPFRNMALEMLDVSGNGWTAD
TTRNFSQAVNGSQISSLVLAHHIMGSGFGFHNIKDPDHHTFASLGRSSLIQLDLSHGFIF
SLNFRLFGTLKELKVLNLAFNKINKIADQAFHGLDNLQILNMSYNLLGELYNSNFEGLPK
LAYIDLQKNHIGIIQDQTFRFLKKLNTLDLRDNALKTIQFIPSIPTLFLGGNKLVTLPNI
RLTANFIHLSENRLENLDNLYFLLQVPHLQILILNQNRFSNCNQRHAPSENPSLEQLFLG
ENMLQLAWEAGFCWDVFKGLSHLQVLYLNNNYLNFLPPGVFRHLTALRGLSLSYNRLTVL
YPGDLPAHLEVLDLSRNQLLSPDPDLFTSLSAVDLSHNKFVCDCELSTFINWLNQTNVTI
FGSRDDIYCMYPSSLAGSPLNTVSMAGCSEEEVLESLKFSLFILFTVTLTLLFVAILVVM
KFRGFCFICYKKVQRLVFKDPSLGRESDTYKYDAYLCFSGKDFEWVQEALLKNLDAQYSD
QNRLNLCFEERDFVPGEDRISNIQDAVWSSRKVVCLVSRHFLRDGWCLEAFSYAQSRCLA
DLNGTLIMVVVGSLPQYQLMKHQSIRGFVRKQQYLRWPEDLQDVSWFLNKLSQYILKKVK
EKKKDSDIQLQSVTIS
Download sequence
Identical sequences Q59HI7
ENSSSCP00000023398 ENSSSCP00000023398 NP_001335700.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]