SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000023409 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSSCP00000023409
Domain Number - Region: 48-101
Classification Level Classification E-value
Superfamily DEATH domain 0.0043
Family Caspase recruitment domain, CARD 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000023409   Gene: ENSSSCG00000008077   Transcript: ENSSSCT00000025932
Sequence length 191
Comment pep:known_by_projection chromosome:Sscrofa10.2:3:43976371:43985070:-1 gene:ENSSSCG00000008077 transcript:ENSSSCT00000025932 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSVFSASVSEQTYCDRLVQDTPFLTGLGRLSEQQVDRIILQLNRYYPQILSNKDAEKFR
NPKVSLRVRLCDLLGHLQRSGERDCQEFYRALYIHAQPLHSGLPSRHTLHNADPTQLDVX
LASRELSDRGPMAFLTCLGLAAGLALLVYCCPSDPKVLPGTRRVLGFSPVIIDRHVSRFL
LAFLTDDLGGL
Download sequence
Identical sequences ENSSSCP00000008626 ENSSSCP00000023409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]