SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000023592 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000023592
Domain Number 1 Region: 320-608
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.62e-74
Family Protein kinases, catalytic subunit 0.000085
Further Details:      
 
Domain Number 2 Region: 42-105
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000866
Family LIM domain 0.0022
Further Details:      
 
Domain Number 3 Region: 100-133
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000228
Family LIM domain 0.0046
Further Details:      
 
Domain Number 4 Region: 149-250
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000434
Family PDZ domain 0.01
Further Details:      
 
Domain Number 5 Region: 12-41
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000177
Family LIM domain 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000023592   Gene: ENSSSCG00000030378   Transcript: ENSSSCT00000025955
Sequence length 638
Comment pep:known_by_projection chromosome:Sscrofa10.2:3:10936405:10962039:1 gene:ENSSSCG00000030378 transcript:ENSSSCT00000025955 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WRDPKEGGMGSELPVCASCGQRIYDGQYLQALNADWHADCFRCCECSASLSHQYYEKDGQ
LFCKKDYWARYGESCHGCSEHITKGLVMVAGELKYHPECFICLTCGTFIGDGDTYTLVEH
SKLYCGHCYYQTVVTPVIEQILPDSPGSHLPHTVTLVSIPASAHGKRGLSVSIDPPHGPP
GCSTEHSHTVRVQGVDPGCMSPDVKNSIHVGDRILEINGTPIRNVPLDEIDLLIQETSRL
LQLTLEHDPHDTLGHGLGPEPSPLASPALTPSGEAGTSSRQKPVLRSCSIDRSPGAGSLG
SPASQRKDLGRSESLRVVCRPHRIFRPSDLIHGEVLGKGCFGQAIKVTHRETGEVMVMKE
LIRFDEETQRTFLKEVKVMRCLEHPNVLKFIGVLYKDKRLNFITEYIKGGTLRGIIKSMD
SQYPWSQRVSFAKDIASGMAYLHSMNIIHRDLNSHNCLVRENKNVVVADFGLARLMVDEK
TQPEDLRSLKKPDRKKRYTVVGNPYWMAPEMINGRSYDEKVDVFSFGIVLCEIIGRVNAD
PDYLPRTMDFGLNVRGFLDRYCPPNCPPSFFPITVRCCDLDPEKRPSFVKLEQWLETLRM
HLAGHLPLGPQLEQLDRGFWETYRRGESGLPAHPEVPD
Download sequence
Identical sequences ENSSSCP00000023592 ENSSSCP00000023592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]