SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000023630 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000023630
Domain Number 1 Region: 190-306
Classification Level Classification E-value
Superfamily Retrovirus capsid protein, N-terminal core domain 1.02e-30
Family Retrovirus capsid protein, N-terminal core domain 0.00011
Further Details:      
 
Domain Number 2 Region: 9-90
Classification Level Classification E-value
Superfamily Retroviral matrix proteins 1.82e-19
Family MMLV matrix protein-like 0.0011
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000023630
Domain Number - Region: 317-377
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 0.0201
Family Retrovirus capsid protein C-terminal domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000023630   Gene: ENSSSCG00000027068   Transcript: ENSSSCT00000024301
Sequence length 393
Comment pep:novel chromosome:Sscrofa10.2:1:296000790:296002080:-1 gene:ENSSSCG00000027068 transcript:ENSSSCT00000024301 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IGESAYKPSVLECMVNNFKKGFSRDYGVKLSPGKLCTLCTLEWPTFGVGWPPEGLYNVIT
GDPGHPYKFPYINQWLETAHLRSPWIQFCTTGQGQCMVLVAKSKKKTLSQKKRYWETKDS
PSMPPHYVLPAPPLGAEGPQMPDSLPPYVSPSPPAPEVPKAISHPQPDSPEPMSRCLQSA
QGEADPALQMPLYYQPFSTADLLNWKHHTPSYSEKPQALIDLLELIFQTHCPTQQLLFTL
FDNEECCQIVTEAQKWLQANAGCQADLANWIREDFPEENPHRDYDTEEGKCNLERYRHAF
LQGKSGAKRPTNIAKTSEILQEPNESPDKFYERLFEALRICTPFDPEVPQNHWMINAAFV
GQAQSDIHKKLQKLKGFAVKNATELLEIANKVF
Download sequence
Identical sequences ENSSSCP00000023630 ENSSSCP00000023630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]