SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000023674 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000023674
Domain Number 1 Region: 44-217
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 5.41e-24
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.0038
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000023674
Domain Number - Region: 3-38
Classification Level Classification E-value
Superfamily TGS-like 0.0144
Family TGS domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000023674   Gene: ENSSSCG00000023422   Transcript: ENSSSCT00000031854
Sequence length 245
Comment pep:novel scaffold:Sscrofa10.2:JH118804.1:110349:123685:1 gene:ENSSSCG00000023422 transcript:ENSSSCT00000031854 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LDLSEWYCRKSILALVDGQPWDMYKPLTKSCEIKFLTFKDDDPGEVNKAYWRSCAMMMGC
VIERAFKDEYVVSLVRAPEVPVIAGAFCYDVVLDKRLDEWMPTKENLHSFTKDARALIYK
DLPFETLEVEAKVALEIFQHNKYKLDFIEEKASQNPERIVKLHRFGDFIDVSEGPLIPRT
SICFQYEVSAVHNLQTQSSLVRRFQGLSLPVHLRAHFTIWNKLLERSRKMVTEDKTKPTE
ESAST
Download sequence
Identical sequences ENSSSCP00000023674 ENSSSCP00000023674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]