SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000023718 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000023718
Domain Number 1 Region: 34-206
Classification Level Classification E-value
Superfamily Lipocalins 2.56e-52
Family Retinol binding protein-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000023718   Gene: ENSSSCG00000024821   Transcript: ENSSSCT00000026932
Sequence length 207
Comment pep:novel scaffold:Sscrofa10.2:GL893127.2:42084:55731:1 gene:ENSSSCG00000024821 transcript:ENSSSCT00000026932 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVLRTPPAALLSPRQVHLQPPSPKMVPTLLLLPALAGLLGVAEGQAFHLGKCPNPPVQEN
FDVNKYLGRWYEIEKIPVSFEKGSCIQANYSLKENGNIKVINKELRADGTVNQIEGEATP
DNITEPAKLGVKFFWLMPSAPYWVLATDYENYALVYSCTTIIWLFHLDHVWILGRNPYLP
XKDILTSNDIDIEKMTITDQVNCPEYL
Download sequence
Identical sequences ENSSSCP00000023718 ENSSSCP00000023718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]