SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000023811 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000023811
Domain Number 1 Region: 8-109
Classification Level Classification E-value
Superfamily DEATH domain 5.5e-30
Family DEATH domain, DD 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000023811   Gene: ENSSSCG00000000475   Transcript: ENSSSCT00000032082
Sequence length 110
Comment pep:known_by_projection chromosome:Sscrofa10.2:5:33800341:33828695:1 gene:ENSSSCG00000000475 transcript:ENSSSCT00000032082 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWTAAGSGGARGALSAHTLLFDMPPTLLGEFCAVLDSCDGALGWRGLAERLSSSWLDVR
HIEKYVDQGKSGTRELLWSWAQKNKTIGDLLQVLQEMGHHRAIHLIANYG
Download sequence
Identical sequences ENSSSCP00000023811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]