SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000023894 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000023894
Domain Number 1 Region: 6-68
Classification Level Classification E-value
Superfamily beta-catenin-interacting protein ICAT 1.09e-27
Family beta-catenin-interacting protein ICAT 0.0000531
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000023894   Gene: ENSSSCG00000030553   Transcript: ENSSSCT00000024073
Sequence length 85
Comment pep:known_by_projection scaffold:Sscrofa10.2:GL896393.1:8932:10992:1 gene:ENSSSCG00000030553 transcript:ENSSSCT00000024073 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSRDLAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPQHSI
DQGESRATAPAPRFSGIASCGSFRS
Download sequence
Identical sequences ENSSSCP00000023894 ENSSSCP00000023894

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]