SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000023906 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000023906
Domain Number 1 Region: 5-104
Classification Level Classification E-value
Superfamily Translation proteins 1.73e-28
Family Ribosomal protein L35ae 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000023906   Gene: ENSSSCG00000006050   Transcript: ENSSSCT00000006639
Sequence length 110
Comment pep:novel chromosome:Sscrofa10.2:4:36508949:36509281:1 gene:ENSSSCG00000006050 transcript:ENSSSCT00000006639 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ILGGLWYKAIFAGFKQGLQNQRENTALLKIDDVYARDETEFYLGKRCAYMYKAKSNTVNP
GRKSKKTRIFWGKVTHANDNSGMVRATFQSNLPAKAIGHRIHVMLYPSRI
Download sequence
Identical sequences ENSSSCP00000023906 ENSSSCP00000023906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]