SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000023919 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000023919
Domain Number 1 Region: 141-403
Classification Level Classification E-value
Superfamily Caspase-like 1.14e-80
Family Caspase catalytic domain 0.00000000544
Further Details:      
 
Domain Number 2 Region: 3-89
Classification Level Classification E-value
Superfamily DEATH domain 1.13e-23
Family Caspase recruitment domain, CARD 0.0000981
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000023919   Gene: ENSSSCG00000028711   Transcript: ENSSSCT00000027757
Sequence length 404
Comment pep:known_by_projection chromosome:Sscrofa10.2:9:39209731:39222235:-1 gene:ENSSSCG00000028711 transcript:ENSSSCT00000027757 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADKILKEKRRLFVRSVAMGTINGLLDELLETRVLNQEEVEIVRGENATVMDKARALIDS
VIRKGPQACQICINHICGDDPHLAGVLELSTGSQSGKCLTVQESQAVVPPFPAPQTVQDN
PVKPASSEPRGSLKLCPPDIAQRLWKEKSAEIYPIMEKSIRTRLALIICNTEFENLPRRD
GADVDIRDMKILLEDLGYSVDVRENLTASDMAIELKAFAARPEHKSSDSTFLVLMSHGIQ
AGICGKKYSEEVPDVLEVNTVFQILNTLNCPSLKDKPKVIIIQACRGEKQGVVWIKDSVG
PSGNSSLLAAEDFEYDAIKKAHIEKDFIAFCSSTPDNVSWRHPLLGSLFIIKLIKILQEH
AWSCDLEEIFRKVRFSFELADGRAQMPTAERVTLTRSFYLFPGY
Download sequence
Identical sequences I3LIL3
ENSSSCP00000023919 ENSSSCP00000023919

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]