SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000024021 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000024021
Domain Number 1 Region: 1-230
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.4e-57
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0028
Further Details:      
 
Domain Number 2 Region: 314-486
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000000181
Family FAD/NAD-linked reductases, N-terminal and central domains 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000024021   Gene: ENSSSCG00000022759   Transcript: ENSSSCT00000029850
Sequence length 534
Comment pep:known_by_projection chromosome:Sscrofa10.2:9:70062355:70078141:1 gene:ENSSSCG00000022759 transcript:ENSSSCT00000029850 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTMVKKVAIIGAGVSGLASIRCCLEEGLEPICFERSNDVGGLWQFSDHAEEGRASIYQSV
FTNSSKEMMCFPDFPYPDDYPNYMHQSKLQEYIKTFAQKKNLLRYIKFETLVSSIKKCPN
FLVTGQWEVISEKDGKQESTIFDAVMICSGHHVYPNLPTDSFPGLDRFQGHYFHSRDYKG
PEVFKGKRVLVIGLGNSGCDIAVELSRLATQVIISTRSGSWVMSRVWDDGYPWDMVYVTR
FASFLRNALPSFVSDWLYVKKMNTWFKHENYGLMPLNGTLRKEPVFNDELPSRILCGTVS
IKPSVKEFTETSAVFEDGTMFEAIDFVIFATGYGYAYPFLDDSIIKSRNNEVILFKGIFP
PLMEKPTLAVIGLVQSLGAAIPTADLQARWVVKVFTNSCSLPTTDEMMDDTDEKMRKKLK
WFGQSQTLQTDYITYMDELGSFIGAKPNIPWLFLTDPQLALEVYFGPCSPYQFRLMGPGK
WNGARKAILTQWDRTIKPTRTRAVTEAKRPQPFYNLLKILLFPVLLLAVLLTFY
Download sequence
Identical sequences ENSSSCP00000024021 ENSSSCP00000024021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]