SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000024183 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000024183
Domain Number 1 Region: 20-139
Classification Level Classification E-value
Superfamily Lysozyme-like 1.22e-45
Family C-type lysozyme 0.0000016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000024183   Gene: ENSSSCG00000024573   Transcript: ENSSSCT00000025257
Sequence length 141
Comment pep:known chromosome:Sscrofa10.2:5:82539971:82542256:1 gene:ENSSSCG00000024573 transcript:ENSSSCT00000025257 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMSFVSLLVVGILFPAIQAKQFTKCELSQVLKDMDGYGDITLPEWICTIFHISGYDTKTI
VHDNGSTEYGLFQINNKLWCRDNQIQSKNICGISCDKFLDDDLTDDMMCAKKILDNEGID
YWLAHKALCSEKLDQWLCEKM
Download sequence
Identical sequences P18137
NP_999525.1.46622 ENSSSCP00000024183 ENSSSCP00000024183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]