SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000024252 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSSCP00000024252
Domain Number - Region: 3-47
Classification Level Classification E-value
Superfamily DEATH domain 0.000224
Family Caspase recruitment domain, CARD 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000024252   Gene: ENSSSCG00000026213   Transcript: ENSSSCT00000029026
Sequence length 600
Comment pep:known_by_projection chromosome:Sscrofa10.2:3:114568215:114571586:-1 gene:ENSSSCG00000026213 transcript:ENSSSCT00000029026 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VNIICFEKVERDSARGVIHMILKTGSEAYKLFLKSFEKWNYPLFQDLHGLSLFHQISKKD
LDGLAQDLKEFYHTPSFLNFYPLGEDIDIIFNLKSTFTELVLWRKDQHLTLSGLLDTLQN
RCIIEGESGKGESTLLQQIATLWASGKCRALTKFKLVFFVYLSKAQGGLFETLCDQLLDI
PDMIRKSTFKAMLLEKGRVLFLLDGYSEFKVQNCPEIEALIKENHCFKNMVNVTATTECL
RHVQQFGVLTVDVGDTLEESTQAFIWRVLIKELAEGLLLQIQKSRCLRNLMKTPLFVVIT
CIIQIGESELHSNTQTTLFHTFCDLLKNKNKHRYRGVALSDFTQTLDHRRDLALEGVFSH
RFDFEPDDLSIVNEDVLLTVGLLCKYTAQRFKPMRKFFYKSFQEYTAGCRLSSLLTSGEP
VEVTKGNSYLPKMDFISDIISKYSNLLMYMCGSSAKATRTALKHLASVYQHGSPINITSF
TECGINLFRGSIAASNLSKEFEDFFCSKSLYINSENIPNYLFDFFEDLSNCASALDFVKL
DFCRGAVASQDKTPEDICRMHTHESSGSYIPSRAVSLFFNWNQEFKTLEITLQDFFFCLN
Download sequence
Identical sequences ENSSSCP00000024252 ENSSSCP00000024252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]