SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000024330 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000024330
Domain Number 1 Region: 3-100
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000258
Family I set domains 0.000017
Further Details:      
 
Domain Number 2 Region: 93-187
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000182
Family Fibronectin type III 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000024330   Gene: ENSSSCG00000029947   Transcript: ENSSSCT00000031714
Sequence length 192
Comment pep:novel chromosome:Sscrofa10.2:6:92947611:92979095:-1 gene:ENSSSCG00000029947 transcript:ENSSSCT00000031714 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRIQNVEVNAGQFATFQCSAIGRTVAGDRLWLQGIDVRDAPLKEIKVTSSRGFIASFNVV
NTTKRDAGKYRCMIRTDGGVGISNYAELVVKEPPVPIAPPQLASVGATYLWIQLNANSIN
GDGPIVAREVEYCTASGSWNDRQPVDSTNYKIGHLDPDTEYEISVLLTRPGEGGTGSPGP
ALRTRTKCADTP
Download sequence
Identical sequences ENSSSCP00000024330 ENSSSCP00000024330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]