SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000024348 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000024348
Domain Number 1 Region: 61-82,169-246,288-379
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000000242
Family FAD/NAD-linked reductases, N-terminal and central domains 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000024348   Gene: ENSSSCG00000021184   Transcript: ENSSSCT00000031219
Sequence length 551
Comment pep:known_by_projection chromosome:Sscrofa10.2:4:51349865:51376024:-1 gene:ENSSSCG00000021184 transcript:ENSSSCT00000031219 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVWCCRCSLAGHFRRNYSDTETEGEIFNSLVQYFGDNLGRKVKAMPLVEETSLLEDSSV
TLPVVVIGNGPSGICLSYMLSGYRPYLSSEAIHPNTILHSKLEEARHLSIVDQDLEYLSE
GLEGRSSNPVAVLFDTLLHPDADFGYDYPSVLHWKLEQHHYIPHLVLGKGPPGGAWHNME
GSRLTISFGNWMELPGLKFKDWVSTKRRNLKGDRVMPEEIARYYKHYVKVMGLQKNFREN
TYITSVSRLYRDQVDNDGQDRDISTPHLQIEKSKFIKRNWEIRGYQRIAEGSHVPFCLFA
ENVALATGTLDSPGRLEIEGEDFPFVFHSMPEFGAAISKGKLRGKVDPVLIVGSGLTAAD
AVLCAYNNNVPVIHVFRRRVTDPSLIFKQLPKKLYPEYHKVYHMMCTQSYSLDSNLLSDY
TSFPEHHVLSFKSDMKCILQNISGLKKIFKLSAAVVLIGSHPNLSFLKEQGCYLGHNSSQ
PITCKGNPVEIDAYTYECVKEANLFALGPLVGDNFVRFLKGGALGVTRCLATRQKKKQHL
FVERGGGDGIA
Download sequence
Identical sequences ENSSSCP00000024348 9823.ENSSSCP00000006539 ENSSSCP00000024348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]